Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPT1A Peptide - C-terminal region

CPT1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPT1A, CPT1

UniProt

P50416

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPT1A Rabbit Polyclonal Antibody (orb588574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001867

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF1 (NKX2-1) (NM_003317) Human Over-expression Lysate
LY401141 100 µg

TTF1 (NKX2-1) (NM_003317) Human Over-expression Lysate

Sign In for Pricing
View Details
Tide Quencher™ 8 CPG [TQ8 CPG] *1000 Å*
2133-AAT 100 mg

Tide Quencher™ 8 CPG [TQ8 CPG] *1000 Å*

Sign In for Pricing
View Details
COX6B2 (NM_144613) Human Recombinant Protein
TP306224 20 µg

COX6B2 (NM_144613) Human Recombinant Protein

Sign In for Pricing
View Details
EFEMP1 Antibody
8C15601-AAT 50 µg

EFEMP1 Antibody

Sign In for Pricing
View Details
M-CSF (CSF1) (NM_172212) Human Over-expression Lysate
LY430359 100 µg

M-CSF (CSF1) (NM_172212) Human Over-expression Lysate

Sign In for Pricing
View Details
BCAT2 Rabbit Polyclonal Antibody
TA373959 100 µL

BCAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details