Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPT1A Peptide - C-terminal region

CPT1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPT1A, CPT1

UniProt

P50416

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPT1A Rabbit Polyclonal Antibody (orb588574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001867

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRBA1 activation kit by CRISPRa
GA113613 1 Kit

Human KRBA1 activation kit by CRISPRa

Sign In for Pricing
View Details
MMAE Rabbit Monoclonal Antibody [Clone ID: 9C4]
TA421193S 10 µg

MMAE Rabbit Monoclonal Antibody [Clone ID: 9C4]

Sign In for Pricing
View Details
Biuret Protein Colorimetric Assay Kit
E-BC-K165-M-01 96 T (80 samples)

Biuret Protein Colorimetric Assay Kit

Sign In for Pricing
View Details
Biuret Protein Colorimetric Assay Kit
E-BC-K165-M-02 500 Assays

Biuret Protein Colorimetric Assay Kit

Sign In for Pricing
View Details
RGS9 Antibody (Biotin)
KB-28556-01 50 μL

RGS9 Antibody (Biotin)

Sign In for Pricing
View Details
RGS9 Antibody (Biotin)
KB-28556-02 100 µL

RGS9 Antibody (Biotin)

Sign In for Pricing
View Details