Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX10 Peptide - C-terminal region

DDX10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DDX10

UniProt

Q13206

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX10 Rabbit Polyclonal Antibody (orb327446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004389

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) APC
MBS6138156-01 0.1 mL

PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) APC

Sign In for Pricing
View Details
PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) APC
MBS6138156-02 5x 0.1 mL

PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) APC

Sign In for Pricing
View Details
Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit
MBS9915321-01 48 Well

Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit

Sign In for Pricing
View Details
Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit
MBS9915321-02 96 Well

Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit

Sign In for Pricing
View Details
Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit
MBS9915321-03 5x 96 Well

Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit

Sign In for Pricing
View Details
Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit
MBS9915321-04 10x 96 Well

Bovine E3 Ubiquitin-Protein Ligase UHRF1 (UHRF1) ELISA Kit

Sign In for Pricing
View Details