GNAT1 Peptide - C-terminal region
GNAT1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GNAT1, GNATR
UniProt
P11488
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GNAT1 Rabbit Polyclonal Antibody (orb588607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_653082
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FFEKIKKAHLSICFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP227695 200 Reactions
PPP1A (PPP1CA) Human qPCR Primer Pair (NM_002708)
Sign In for Pricing
View Details 
BNC881869-100 1x 100 µL
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-S497052-50MG 50 mg
Beta-Sitosterol-d7 (mixture of diasteromers)
Sign In for Pricing
View Details 
BNC941464-500 1x 500 µL
CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details