Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAT1 Peptide - C-terminal region

GNAT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GNAT1, GNATR

UniProt

P11488

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNAT1 Rabbit Polyclonal Antibody (orb588607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_653082

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFEKIKKAHLSICFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF594 conjugate, 0.1mg/mL
BNC942278-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cannabigerorcinic Acid
TRC-C175403-50MG 50 mg

Cannabigerorcinic Acid

Sign In for Pricing
View Details
FITC Anti-Human CD41 Antibody[HIP8]
E-AB-F1088C-01 20 Tests

FITC Anti-Human CD41 Antibody[HIP8]

Sign In for Pricing
View Details
FITC Anti-Human CD41 Antibody[HIP8]
E-AB-F1088C-02 100 Tests

FITC Anti-Human CD41 Antibody[HIP8]

Sign In for Pricing
View Details
FITC Anti-Human CD41 Antibody[HIP8]
E-AB-F1088C-03 2x 100 Tests

FITC Anti-Human CD41 Antibody[HIP8]

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), CF740 conjugate, 0.1mg/mL
BNC740173-100 1x 100 µL

CD45 / LCA (136-4B5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details