CEACAM8 Peptide - middle region
CEACAM8 Peptide - middle region
Product Specifications
Product Name Alternative
CD67, CGM6, CD66b, NCA-95
UniProt
P31997
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001807.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0053967-01 20 µL
Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
Sign In for Pricing
View Details TRV-0053967-02 100 µL
Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
Sign In for Pricing
View Details TRV-0053967-03 200 µL
Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
Sign In for Pricing
View Details TRV-0053967-04 1 mL
Monoclonal Antibody to Fibroblast Growth Factor Receptor 1 (FGFR1)
Sign In for Pricing
View Details GTR15266284 1 Vial
Lentiviral mouse Arhgef26 shRNA (UAS) - Lentiviral mouse Arhgef26 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details