Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM8 Peptide - middle region

CEACAM8 Peptide - middle region

Product Specifications

Product Name Alternative

CD67, CGM6, CD66b, NCA-95

UniProt

P31997

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001807.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SEMA3F sgRNA gene knockout kit - Lentiviral human SEMA3F sgRNA gene knockout kit (25)
GTR15359868 1 Vial

Lentiviral human SEMA3F sgRNA gene knockout kit - Lentiviral human SEMA3F sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MAGED2 (BCG1) discontinued
511300 100 µg

MAGED2 (BCG1) discontinued

Sign In for Pricing
View Details
Selumetinib Impurity 10
RM-S052110-01 10 mg

Selumetinib Impurity 10

Sign In for Pricing
View Details
Selumetinib Impurity 10
RM-S052110-02 25 mg

Selumetinib Impurity 10

Sign In for Pricing
View Details
Selumetinib Impurity 10
RM-S052110-03 50 mg

Selumetinib Impurity 10

Sign In for Pricing
View Details
Selumetinib Impurity 10
RM-S052110-04 100 mg

Selumetinib Impurity 10

Sign In for Pricing
View Details