Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX9 Peptide - middle region

PAX9 Peptide - middle region

Product Specifications

Product Name Alternative

STHAG3

UniProt

P55771

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_006185.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cytochrome P450 1B1 Antibody
RC-15853-01 50 μL

Recombinant Cytochrome P450 1B1 Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 1B1 Antibody
RC-15853-02 100 µL

Recombinant Cytochrome P450 1B1 Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 1B1 Antibody
RC-15853-03 1 mL

Recombinant Cytochrome P450 1B1 Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL-3 protein (His Tag)
PKSM041460-01 20 µg

Recombinant Mouse IL-3 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-3 protein (His Tag)
PKSM041460-02 100 µg

Recombinant Mouse IL-3 protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623517 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details