Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX9 Peptide - middle region

PAX9 Peptide - middle region

Product Specifications

Product Name Alternative

STHAG3

UniProt

P55771

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_006185.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATC (NM_176818) Human Recombinant Protein
TP315964M 100 µg

GATC (NM_176818) Human Recombinant Protein

Sign In for Pricing
View Details
Human ST3GAL5 activation kit by CRISPRa
GA105903 1 Kit

Human ST3GAL5 activation kit by CRISPRa

Sign In for Pricing
View Details
RCC1 Rabbit Polyclonal Antibody
TA362605 100 µL

RCC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG2c,  40nm
GM-403-40 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG2c, 40nm

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL
BNC471118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Canine Integrin alpha M beta 2 (ITGAM&ITGB2) Heterodimer Protein, His Tag&Tag Free (MALS verified)
IT2-C52E2-1mg 1 mg

Canine Integrin alpha M beta 2 (ITGAM&ITGB2) Heterodimer Protein, His Tag&Tag Free (MALS verified)

Sign In for Pricing
View Details