Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1G Peptide - C-terminal region

PPM1G Peptide - C-terminal region

Product Specifications

Product Name Alternative

PP2CG, PPP2CG, PP2CGAMMA

UniProt

O15355

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_817092.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Block, 96x2ml plate, for MultiTherm Touch
H5100-2DWMP 1 Each

Block, 96x2ml plate, for MultiTherm Touch

Sign In for Pricing
View Details
RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1)
132430 100 µg

RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1)

Sign In for Pricing
View Details
CARD16 Rabbit Polyclonal Antibody
orb3069087-01 30 µL

CARD16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CARD16 Rabbit Polyclonal Antibody
orb3069087-02 50 µL

CARD16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CARD16 Rabbit Polyclonal Antibody
orb3069087-03 100 µL

CARD16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CARD16 Rabbit Polyclonal Antibody
orb3069087-04 200 µL

CARD16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details