Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1G Peptide - C-terminal region

PPM1G Peptide - C-terminal region

Product Specifications

Product Name Alternative

PP2CG, PPP2CG, PP2CGAMMA

UniProt

O15355

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_817092.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Guanylate Cyclase Activator 2B ELISA Kit
MBS763052-01 48 Well

Human Guanylate Cyclase Activator 2B ELISA Kit

Sign In for Pricing
View Details
Human Guanylate Cyclase Activator 2B ELISA Kit
MBS763052-02 96 Well

Human Guanylate Cyclase Activator 2B ELISA Kit

Sign In for Pricing
View Details
Human Guanylate Cyclase Activator 2B ELISA Kit
MBS763052-03 5x 96 Well

Human Guanylate Cyclase Activator 2B ELISA Kit

Sign In for Pricing
View Details
Human Guanylate Cyclase Activator 2B ELISA Kit
MBS763052-04 10x 96 Well

Human Guanylate Cyclase Activator 2B ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Spag7 shRNA (UAS) - Lentiviral mouse Spag7 shRNA (UAS) (100)
GTR15264714 1 Vial

Lentiviral mouse Spag7 shRNA (UAS) - Lentiviral mouse Spag7 shRNA (UAS) (100)

Sign In for Pricing
View Details
Src Antibody
ABF6161 100 µg

Src Antibody

Sign In for Pricing
View Details