PSG1 Peptide - C-terminal region
PSG1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SP1, B1G1, PBG1, CD66f, PSBG1, PSG95, PSGGA, DHFRP2, PSBG-1, PSGIIA, FL-NCA-1/2, PS-beta-C/D, PS-beta-G-1
UniProt
P11464
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001171754.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-11278 0.1 mg
beta Adducin Overexpression Lysate (Native) - (Dry Ice)
Sign In for Pricing
View Details 
M1500P 50 µg
MADD, Blocking Peptide (MAP Kinase-activating Death Domain Protein, Differentially Expressed in Normal and Neoplastic Cells, DENN, Insulinoma Glucagonoma Clone 20, IG20, KIAA0358, Rab3 GDP/GTP Exchange Factor, RAB3GEP)
Sign In for Pricing
View Details 