Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6A Peptide - C-terminal region

RAB6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB6

UniProt

P20340

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001230647.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRLF3 (NM_015986) Human Mass Spec Standard
PH304326 10 µg

CRLF3 (NM_015986) Human Mass Spec Standard

Sign In for Pricing
View Details
MCM2 Antibody
orb685444 100 µL

MCM2 Antibody

Sign In for Pricing
View Details
5-Bromopyridine-2-thiol
435870-01 100 mg

5-Bromopyridine-2-thiol

Sign In for Pricing
View Details
5-Bromopyridine-2-thiol
435870-02 250 mg

5-Bromopyridine-2-thiol

Sign In for Pricing
View Details
PKLR, CT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (FITC)
MBS6496246-01 0.2 mL

PKLR, CT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (FITC)

Sign In for Pricing
View Details
PKLR, CT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (FITC)
MBS6496246-02 5x 0.2 mL

PKLR, CT (Pyruvate Kinase Isozymes R/L, Pyruvate Kinase 1, R-type/L-type Pyruvate Kinase, Red Cell/Liver Pyruvate Kinase, PK1, PKL) (FITC)

Sign In for Pricing
View Details