What is the catalog number for RAB6A Peptide - C-terminal region?

The catalog number for RAB6A Peptide - C-terminal region is orb2001554.

What sizes are available for RAB6A Peptide - C-terminal region?

RAB6A Peptide - C-terminal region is available in the following size(s): 100 µg.

Is RAB6A Peptide - C-terminal region in stock?

RAB6A Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

RAB6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RAB6

UniProt

P20340

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001230647.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F8010-02A-ML750 100 µL

FBP1, ID (Fructose-1,6-bisphosphatase 1, FBPase 1, D-fructose-1,6-bisphosphate 1-phosphohydrolase 1, FBP) (MaxLight 750) discontinued

Sign In for Pricing

View Details

NBP2-97056FR 0.1 mL

Rabbit Polyclonal THEM2 Antibody [DyLight 680]

Sign In for Pricing

View Details

sc-230231 1 g

2-Cyanobenzaldehyde

Sign In for Pricing

View Details

36108161 1.0 µg

PCDH17 AAV siRNA Pooled Vector

Sign In for Pricing

View Details

MBS7092984 0.05 mg (Yeast)

Recombinant Human Lymphocyte transmembrane adapter 1 (LAX1), partial

Sign In for Pricing

View Details

NBP1-98969-50ug 50 µg

Recombinant Human FABP12 Protein

Sign In for Pricing

View Details