RPS6KA3 Peptide - middle region
RPS6KA3 Peptide - middle region
Product Specifications
Product Name Alternative
CLS, RSK, HU-3, RSK2, MRX19, ISPK-1, p90-RSK2, pp90RSK2, MAPKAPK1B, S6K-alpha3
UniProt
P51812
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_004577.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR213842L3V 200 µL
Olfr1262 (NM_146974) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
E3336Ra-01 48 Well
Rat mid-regional pro-atrial natriuretic peptide, MR-proANP ELISA KIT
Sign In for Pricing
View Details E3336Ra-02 96 Well
Rat mid-regional pro-atrial natriuretic peptide, MR-proANP ELISA KIT
Sign In for Pricing
View Details E3336Ra-03 5x 96 Tests
Rat mid-regional pro-atrial natriuretic peptide, MR-proANP ELISA KIT
Sign In for Pricing
View Details E3336Ra-04 10x 96 Tests
Rat mid-regional pro-atrial natriuretic peptide, MR-proANP ELISA KIT
Sign In for Pricing
View Details