Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS6KA3 Peptide - middle region

RPS6KA3 Peptide - middle region

Product Specifications

Product Name Alternative

CLS, RSK, HU-3, RSK2, MRX19, ISPK-1, p90-RSK2, pp90RSK2, MAPKAPK1B, S6K-alpha3

UniProt

P51812

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004577.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF4E Antibody
MBS8324747-01 0.03 mL

Anti-EIF4E Antibody

Sign In for Pricing
View Details
Anti-EIF4E Antibody
MBS8324747-02 0.05 mL

Anti-EIF4E Antibody

Sign In for Pricing
View Details
Anti-EIF4E Antibody
MBS8324747-03 0.1 mL

Anti-EIF4E Antibody

Sign In for Pricing
View Details
Anti-EIF4E Antibody
MBS8324747-04 0.2 mL

Anti-EIF4E Antibody

Sign In for Pricing
View Details
Anti-EIF4E Antibody
MBS8324747-05 5x 0.2 mL

Anti-EIF4E Antibody

Sign In for Pricing
View Details
RAB6A Rabbit pAb
E2860080 100 µL

RAB6A Rabbit pAb

Sign In for Pricing
View Details