Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A4 Peptide - C-terminal region

SLC2A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLUT4

UniProt

P14672

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001033.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP11 (N-term) Rabbit Polyclonal Antibody
AP17378PU-N 400 µL

FKBP11 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AQP12B (NM_001102467) Human Over-expression Lysate
LY420153 100 µg

AQP12B (NM_001102467) Human Over-expression Lysate

Sign In for Pricing
View Details
3,4-Dihydro-7-hydroxy-1(2H)-quinolinebutanoic Acid Ethyl Ester
TRC-D191130-50MG 50 mg

3,4-Dihydro-7-hydroxy-1(2H)-quinolinebutanoic Acid Ethyl Ester

Sign In for Pricing
View Details
IMPDH2 Human Gene Knockout Kit (CRISPR)
KN202977LP 1 Kit

IMPDH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TEM7 (PLXDC1) (NM_020405) Human Over-expression Lysate
LC402784 20 µg

TEM7 (PLXDC1) (NM_020405) Human Over-expression Lysate

Sign In for Pricing
View Details
TBX20 Mouse Monoclonal Antibody [Clone ID: OTI3D12]
CF809355 100 µg

TBX20 Mouse Monoclonal Antibody [Clone ID: OTI3D12]

Sign In for Pricing
View Details