Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A4 Peptide - C-terminal region

SLC2A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLUT4

UniProt

P14672

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001033.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSS (NM_001001438) Human Over-expression Lysate
LY424356 100 µg

LSS (NM_001001438) Human Over-expression Lysate

Sign In for Pricing
View Details
gamma-Tocopherol
TRC-T526140-25MG 25 mg

gamma-Tocopherol

Sign In for Pricing
View Details
Glycidyl Stearate-d35
TRC-G615987-5MG 5 mg

Glycidyl Stearate-d35

Sign In for Pricing
View Details
Human CYP2W1 activation kit by CRISPRa
GA110360 1 Kit

Human CYP2W1 activation kit by CRISPRa

Sign In for Pricing
View Details
OR11H1 Human Gene Knockout Kit (CRISPR)
KN421962 1 Kit

OR11H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP565437 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details