Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP10 Peptide - middle region

TCP10 Peptide - middle region

Product Specifications

Product Name Alternative

TCP10A

UniProt

Q12799

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004601.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGRPTPGAERRGVSEDGKIMHPSSRSPQNSGGRKSPVQASQATTLQEQTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FST Peptide - middle region
MBS3231255-01 0.1 mg

FST Peptide - middle region

Sign In for Pricing
View Details
FST Peptide - middle region
MBS3231255-02 5x 0.1 mg

FST Peptide - middle region

Sign In for Pricing
View Details
HSPA8 Antibody, HRP conjugated
A39724-100UG 100 µg

HSPA8 Antibody, HRP conjugated

Sign In for Pricing
View Details
SLC31A2 Polyclonal Antibody
A63438-020 20 µL

SLC31A2 Polyclonal Antibody

Sign In for Pricing
View Details
Methyl 3- (3,5-di-tert-butyl-4-hydroxyphenyl) propionate
455061-01 1 g

Methyl 3- (3,5-di-tert-butyl-4-hydroxyphenyl) propionate

Sign In for Pricing
View Details
Methyl 3- (3,5-di-tert-butyl-4-hydroxyphenyl) propionate
455061-02 5 g

Methyl 3- (3,5-di-tert-butyl-4-hydroxyphenyl) propionate

Sign In for Pricing
View Details