Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP10 Peptide - middle region

TCP10 Peptide - middle region

Product Specifications

Product Name Alternative

TCP10A

UniProt

Q12799

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004601.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGRPTPGAERRGVSEDGKIMHPSSRSPQNSGGRKSPVQASQATTLQEQTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXC4 CRISPR Knock Out 293T Cell Line (Human)
23834141 1x 10^6 Cells / 1.0 mL

HOXC4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
UBA52P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV788912 1.0 µg DNA

UBA52P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Goose Carbonic Anhydrase VI ELISA Kit
MBS062617 Inquire

Goose Carbonic Anhydrase VI ELISA Kit

Sign In for Pricing
View Details
Prepro VIP (81-122), Human
MBS5789347 Inquire

Prepro VIP (81-122), Human

Sign In for Pricing
View Details
POLDIP2 Human shRNA Plasmid Kit (Locus ID 26073)
TL302380 1 Kit

POLDIP2 Human shRNA Plasmid Kit (Locus ID 26073)

Sign In for Pricing
View Details
AP1G1 Rabbit mAb
A19269-01 20 µL

AP1G1 Rabbit mAb

Sign In for Pricing
View Details