Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK5 Peptide - middle region

KCNK5 Peptide - middle region

Product Specifications

Product Name Alternative

TASK2, K2p5.1, KCNK5b, TASK-2

UniProt

O95279

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003731.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEETYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF647 conjugate, 0.1mg/mL
BNC472745-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM150B (NM_001282011) Human Tagged ORF Clone
RG236778 10 µg

TMEM150B (NM_001282011) Human Tagged ORF Clone

Sign In for Pricing
View Details
RNF149 Human Gene Knockout Kit (CRISPR)
KN207979RB 1 Kit

RNF149 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS638359 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human WDPCP activation kit by CRISPRa
GA109524 1 Kit

Human WDPCP activation kit by CRISPRa

Sign In for Pricing
View Details
MAGEC1 Polyclonal Antibody
E-AB-13395-01 20 µL

MAGEC1 Polyclonal Antibody

Sign In for Pricing
View Details