Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK5 Peptide - middle region

KCNK5 Peptide - middle region

Product Specifications

Product Name Alternative

TASK2, K2p5.1, KCNK5b, TASK-2

UniProt

O95279

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003731.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEETYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HIF1-beta Antibody
RC-15407-01 50 μL

Recombinant HIF1-beta Antibody

Sign In for Pricing
View Details
Recombinant HIF1-beta Antibody
RC-15407-02 100 µL

Recombinant HIF1-beta Antibody

Sign In for Pricing
View Details
Recombinant HIF1-beta Antibody
RC-15407-03 1 mL

Recombinant HIF1-beta Antibody

Sign In for Pricing
View Details
Recombinant Human GPC3 protein (His tag)
PDEH100959-01 20 µg

Recombinant Human GPC3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GPC3 protein (His tag)
PDEH100959-02 100 µg

Recombinant Human GPC3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GPC3 protein (His tag)
PDEH100959-03 500 µg

Recombinant Human GPC3 protein (His tag)

Sign In for Pricing
View Details