What is the catalog number for KDM4A Peptide - middle region?

The catalog number for KDM4A Peptide - middle region is orb2001476.

What sizes are available for KDM4A Peptide - middle region?

KDM4A Peptide - middle region is available in the following size(s): 100 µg.

Is KDM4A Peptide - middle region in stock?

KDM4A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

KDM4A Peptide - middle region

Product Specifications

Product Name Alternative

JMJD2, JHDM3A, JMJD2A, TDRD14A

UniProt

O75164

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055478.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BP029-50ug 50 µg

Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein (N-His)

Sign In for Pricing

View Details

TA504981 100 µL

FTCD Mouse Monoclonal Antibody [Clone ID: OTI8C2]

Sign In for Pricing

View Details

MBS1357135 Inquire

Recombinant DNA-directed RNA polymerase subunit beta' (rpoC), partial

Sign In for Pricing

View Details

abx335418-01 20 µg

Topoisomerase I (TOP1) Antibody (HRP)

Sign In for Pricing

View Details

abx335418-02 50 µg

Topoisomerase I (TOP1) Antibody (HRP)

Sign In for Pricing

View Details

abx335418-03 100 µg

Topoisomerase I (TOP1) Antibody (HRP)

Sign In for Pricing

View Details