Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCLRE1A Peptide - N-terminal region

DCLRE1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSO2, SNM1, SNM1A

UniProt

Q6PJP8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001258745.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNRKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1538 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7338603 1.0 µg DNA

Olr1538 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein FLJ43826
MBS1387125-01 0.02 mg (E-Coli)

Recombinant Human Putative uncharacterized protein FLJ43826

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein FLJ43826
MBS1387125-02 0.02 mg (Yeast)

Recombinant Human Putative uncharacterized protein FLJ43826

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein FLJ43826
MBS1387125-03 0.1 mg (E-Coli)

Recombinant Human Putative uncharacterized protein FLJ43826

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein FLJ43826
MBS1387125-04 0.1 mg (Yeast)

Recombinant Human Putative uncharacterized protein FLJ43826

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein FLJ43826
MBS1387125-05 0.02 mg (Baculovirus)

Recombinant Human Putative uncharacterized protein FLJ43826

Sign In for Pricing
View Details