UGT2A1 Peptide - middle region
UGT2A1 Peptide - middle region
Product Specifications
Product Name Alternative
UDPGT2A1
UniProt
Q9Y4X1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001099147.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS102380-01 48 Well
Hamster Adrenergic Receptor Beta Kinase 1 ELISA Kit
Sign In for Pricing
View Details MBS102380-02 96 Well
Hamster Adrenergic Receptor Beta Kinase 1 ELISA Kit
Sign In for Pricing
View Details MBS102380-03 5x 96 Well
Hamster Adrenergic Receptor Beta Kinase 1 ELISA Kit
Sign In for Pricing
View Details MBS102380-04 10x 96 Well
Hamster Adrenergic Receptor Beta Kinase 1 ELISA Kit
Sign In for Pricing
View Details 
MBS2080173-01 0.1 mL
APC-Linked Polyclonal Antibody to Lymphocyte Antigen 96 (LY96)
Sign In for Pricing
View Details MBS2080173-02 0.2 mL
APC-Linked Polyclonal Antibody to Lymphocyte Antigen 96 (LY96)
Sign In for Pricing
View Details