UGT2A1 Peptide - middle region
UGT2A1 Peptide - middle region
Product Specifications
Product Name Alternative
UDPGT2A1
UniProt
Q9Y4X1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001099147.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15153013 1 Vial
Lentiviral mouse Srsf9 shRNA (UAS) - Lentiviral mouse Srsf9 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
ARP46132_P050-FITC 100 µL
BCAT1 Antibody - N-terminal region : FITC (ARP46132_P050-FITC)
Sign In for Pricing
View Details SL1044Hu-01 48 Tests
Human Legionella antibody IgA, LP Ab-IgA ELISA Kit
Sign In for Pricing
View Details SL1044Hu-02 96 Tests
Human Legionella antibody IgA, LP Ab-IgA ELISA Kit
Sign In for Pricing
View Details 042147-ML490 100 µL
SOST, NT (SOST, Sclerostin) (MaxLight 490) discontinued
Sign In for Pricing
View Details 