Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHMT2 Peptide - middle region

BHMT2 Peptide - middle region

Product Specifications

UniProt

Q9H2M3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001171476.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2B1 Human Gene Knockout Kit (CRISPR)
KN422333 1 Kit

SH2B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Formyl Linagliptin
TRC-F700670-50MG 50 mg

N-Formyl Linagliptin

Sign In for Pricing
View Details
6-Bromopicolinic acid
TRC-B686623-500MG 500 mg

6-Bromopicolinic acid

Sign In for Pricing
View Details
Recombinant Human C12orf53 Protein (Fc Tag)
PKSH030683 100 µg

Recombinant Human C12orf53 Protein (Fc Tag)

Sign In for Pricing
View Details
TPOR Recombinant Rabbit Monoclonal Antibody [JE58-00]
HA722068 100 µL

TPOR Recombinant Rabbit Monoclonal Antibody [JE58-00]

Sign In for Pricing
View Details
TSH beta (TSHB) Rabbit Polyclonal Antibody
TA385478 100 µL

TSH beta (TSHB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details