Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHMT2 Peptide - middle region

BHMT2 Peptide - middle region

Product Specifications

UniProt

Q9H2M3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001171476.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H5]
TA501583BM 100 µL

NEK11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H5]

Sign In for Pricing
View Details
CD3 epsilon Recombinant Rabbit Monoclonal Antibody [SY0239]
ET1607-29 100 µL

CD3 epsilon Recombinant Rabbit Monoclonal Antibody [SY0239]

Sign In for Pricing
View Details
Human FGF-19 Recombinant Rabbit monoclonal Antibody
HA725100 100 µL

Human FGF-19 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SLC6A19 (NM_001003841) Human Over-expression Lysate
LY424027 100 µg

SLC6A19 (NM_001003841) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF749 (NM_001023561) Human Over-expression Lysate
LY422604 100 µg

ZNF749 (NM_001023561) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176C-01 50 Tests

FITC Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details