Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1AIP1 Peptide - C-terminal region

TOR1AIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LAP1, LAP1B

UniProt

Q5JTV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001254507.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO44 Antibody
59-868 400 µL

FBXO44 Antibody

Sign In for Pricing
View Details
Bestrophin 2 (BEST2) (NM_017682) Human Untagged Clone
SC304510 10 µg

Bestrophin 2 (BEST2) (NM_017682) Human Untagged Clone

Sign In for Pricing
View Details
Monkey follicle-stimulating hormone, FSH ELISA Kit
MBS700817-01 24 Well (LIMIT 1)

Monkey follicle-stimulating hormone, FSH ELISA Kit

Sign In for Pricing
View Details
Monkey follicle-stimulating hormone, FSH ELISA Kit
MBS700817-02 48 Well

Monkey follicle-stimulating hormone, FSH ELISA Kit

Sign In for Pricing
View Details
Monkey follicle-stimulating hormone, FSH ELISA Kit
MBS700817-03 96 Well

Monkey follicle-stimulating hormone, FSH ELISA Kit

Sign In for Pricing
View Details
Monkey follicle-stimulating hormone, FSH ELISA Kit
MBS700817-04 5x 96 Well

Monkey follicle-stimulating hormone, FSH ELISA Kit

Sign In for Pricing
View Details