Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1 Peptide - N-terminal region

STEAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

STEAP, PRSS24

UniProt

Q9UHE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036581.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (Breast Marker) (BRCA1/2986), CF647 conjugate, 0.1mg/mL
BNC472986-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/2986), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), 0.2mg/mL
BNUB0950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Rat IL4 protein (His tag)
PDER100162-01 20 µg

Recombinant Rat IL4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat IL4 protein (His tag)
PDER100162-02 100 µg

Recombinant Rat IL4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat IL4 protein (His tag)
PDER100162-03 500 µg

Recombinant Rat IL4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat IL4 protein (His tag)
PDER100162-04 1 mg

Recombinant Rat IL4 protein (His tag)

Sign In for Pricing
View Details