Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORMDL2 Peptide - N-terminal region

ORMDL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MST095, HSPC160, MSTP095, adoplin-2

UniProt

Q53FV1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_054901.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Chloro-2,3-difluorobenzene
sc-351947 1 g

1-Chloro-2,3-difluorobenzene

Sign In for Pricing
View Details
CEACAM4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0426603 1.0 µg DNA

CEACAM4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
GENLISA Human Thy-1 Membrane Glycoprotein (THY1/CD90) ELISA
KBH16787 1x 96 Well

GENLISA Human Thy-1 Membrane Glycoprotein (THY1/CD90) ELISA

Sign In for Pricing
View Details
Recombinant Toxoplasma Gondii P24 (GRA 1)
7-07540 100 µg

Recombinant Toxoplasma Gondii P24 (GRA 1)

Sign In for Pricing
View Details
2610027L16Rik siRNA Oligos set (Mouse)
10462174 3x 5 nmol

2610027L16Rik siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
GTF2IRD1 (NM_016328) Human Tagged ORF Clone
RG202128 10 µg

GTF2IRD1 (NM_016328) Human Tagged ORF Clone

Sign In for Pricing
View Details