What is the catalog number for CHST11 Peptide - middle region?

The catalog number for CHST11 Peptide - middle region is orb2001365.

What sizes are available for CHST11 Peptide - middle region?

CHST11 Peptide - middle region is available in the following size(s): 100 µg.

Is CHST11 Peptide - middle region in stock?

CHST11 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CHST11 Peptide - middle region

Product Specifications

Product Name Alternative

C4ST, C4ST1, C4ST-1, HSA269537

UniProt

Q9NPF2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001167453.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS4506756-01 0.05 mL

Rabbit anti-BAI3 Antibody

Sign In for Pricing

View Details

MBS4506756-02 0.1 mL

Rabbit anti-BAI3 Antibody

Sign In for Pricing

View Details

MBS4506756-03 5x 0.1 mL

Rabbit anti-BAI3 Antibody

Sign In for Pricing

View Details

CC7F338 5x 10^5 Cells/Vial

Rat Mammary Primary Fibroblasts

Sign In for Pricing

View Details

NBP2-70907AF594 0.1 mL

Mouse Monoclonal hnRNP F Antibody (OTI5F5) [Alexa Fluor 594]

Sign In for Pricing

View Details

PT-0891 1 vial

rAAV-hSyn-DIO-hM3D(Gq)-EGFP-WPREs

Sign In for Pricing

View Details