What is the catalog number for CHST11 Peptide - middle region?

The catalog number for CHST11 Peptide - middle region is orb2001365.

What sizes are available for CHST11 Peptide - middle region?

CHST11 Peptide - middle region is available in the following size(s): 100 µg.

Is CHST11 Peptide - middle region in stock?

CHST11 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CHST11 Peptide - middle region

Product Specifications

Product Name Alternative

C4ST, C4ST1, C4ST-1, HSA269537

UniProt

Q9NPF2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001167453.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRC-S789200-1G 1 g

3-Sulfamoylbenzylamine

Sign In for Pricing

View Details

MBS9374654 Inquire

Donkey Apoprotein M (APOM) ELISA Kit

Sign In for Pricing

View Details

A23030-1000 1000 mg

Fmoc-Dap (Alloc) -OH 1000mg

Sign In for Pricing

View Details

38166094 4x 500 ng

Ptpn7-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing

View Details

NBP3-18494JF585 0.1 mL

Rabbit Polyclonal NGDN Antibody [Janelia Fluor 585]

Sign In for Pricing

View Details

TA379759 100 µL

PDHX Rabbit Polyclonal Antibody

Sign In for Pricing

View Details