SNX3 Peptide - N-terminal region
SNX3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SDP3, Grd19, MCOPS8
UniProt
O60493
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001287858.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA86836HU-01 50 µg
Rabbit Anti-Human TBC1D3A/B/C Polyclonal Antibody
Sign In for Pricing
View Details PA86836HU-02 100 µg
Rabbit Anti-Human TBC1D3A/B/C Polyclonal Antibody
Sign In for Pricing
View Details PA86836HU-03 500 µg
Rabbit Anti-Human TBC1D3A/B/C Polyclonal Antibody
Sign In for Pricing
View Details PA86836HU-04 1 mg
Rabbit Anti-Human TBC1D3A/B/C Polyclonal Antibody
Sign In for Pricing
View Details 
MBS2080279-01 0.1 mL
FITC-Linked Polyclonal Antibody to Klotho Beta (KLb)
Sign In for Pricing
View Details MBS2080279-02 0.2 mL
FITC-Linked Polyclonal Antibody to Klotho Beta (KLb)
Sign In for Pricing
View Details