What is the catalog number for FAM49B Peptide - middle region?

The catalog number for FAM49B Peptide - middle region is orb2001321.

What sizes are available for FAM49B Peptide - middle region?

FAM49B Peptide - middle region is available in the following size(s): 100 µg.

Is FAM49B Peptide - middle region in stock?

FAM49B Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

FAM49B Peptide - middle region

Product Specifications

Product Name Alternative

L1, BM-009

UniProt

Q9NUQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001243692.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RMRINNVPAEGENEVNNELANRMSLFYAEATPMLKTLSDATTKFVSENKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-428495-LAC-2 200 µL

MSK1 Lentiviral Activation Particles (m2)

Sign In for Pricing

View Details

25467171 3x 5 nmol

KDELR3 siRNA Oligos set (Human)

Sign In for Pricing

View Details

PV312748 500 ng

TRAPPC4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing

View Details

orb2572539 200 µL

Zebrafish taperin Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing

View Details

CU83-10ug 10 µg

Recombinant Cynomolgus TIM-3/HAVCR2 (N-His)

Sign In for Pricing

View Details

RQ8257 100 µg

PPM1J Antibody / Protein phosphatase 1J

Sign In for Pricing

View Details