Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIMAP6 Peptide - middle region

GIMAP6 Peptide - middle region

Product Specifications

Product Name Alternative

IAN2, IAN6, IAN-2, IAN-6

UniProt

Q6P9H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001231000.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ileum
CS510770 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
Prominin 2 (PROM2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D12]
TA500349BM 100 µL

Prominin 2 (PROM2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D12]

Sign In for Pricing
View Details
Allyl 1,1,2,3,3,3-Hexafluoropropyl Ether
TRC-A544463-500MG 500 mg

Allyl 1,1,2,3,3,3-Hexafluoropropyl Ether

Sign In for Pricing
View Details
NGF Recombinant Rabbit monoclonal Antibody [SI79-01]
ET1606-29-50UL 50 µL

NGF Recombinant Rabbit monoclonal Antibody [SI79-01]

Sign In for Pricing
View Details
Frozen Tissue Sections, Fallopian tube
CS500372 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
Sodium hexacyanoferrate(II) decahydrate
TRC-S634305-5G 5 g

Sodium hexacyanoferrate(II) decahydrate

Sign In for Pricing
View Details