Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIMAP6 Peptide - middle region

GIMAP6 Peptide - middle region

Product Specifications

Product Name Alternative

IAN2, IAN6, IAN-2, IAN-6

UniProt

Q6P9H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001231000.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zilpaterol-13C3
TRC-Z430003-25MG 25 mg

Zilpaterol-13C3

Sign In for Pricing
View Details
Recombinant Human CHGA protein (His tag)
PDMH100095-01 20 µg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CHGA protein (His tag)
PDMH100095-02 100 µg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CHGA protein (His tag)
PDMH100095-03 500 µg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CHGA protein (His tag)
PDMH100095-04 1 mg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
XFD700 acid
1799-AAT 10 mg

XFD700 acid

Sign In for Pricing
View Details