Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAT Peptide - middle region

LAT Peptide - middle region

Product Specifications

Product Name Alternative

LAT1, pp36

UniProt

O43561

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001014987.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)
MBS7030861-01 0.02 mg

Recombinant Human Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)

Sign In for Pricing
View Details
Recombinant Human Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)
MBS7030861-02 0.1 mg

Recombinant Human Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)

Sign In for Pricing
View Details
Recombinant Human Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)
MBS7030861-03 5x 0.1 mg

Recombinant Human Transmembrane anterior posterior transformation protein 1 homolog (TAPT1)

Sign In for Pricing
View Details
Paraffin Tissue Section - Multiple Sclerosis Disease: Brain: Cerebellum
T2236039Msc 5 Slides

Paraffin Tissue Section - Multiple Sclerosis Disease: Brain: Cerebellum

Sign In for Pricing
View Details
Human KDM2A Recombinant Protein, N-His
ARO-P20471-01 50 µg

Human KDM2A Recombinant Protein, N-His

Sign In for Pricing
View Details
Human KDM2A Recombinant Protein, N-His
ARO-P20471-02 100 µg

Human KDM2A Recombinant Protein, N-His

Sign In for Pricing
View Details