Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAT Peptide - middle region

LAT Peptide - middle region

Product Specifications

Product Name Alternative

LAT1, pp36

UniProt

O43561

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001014987.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIMBP2 Antibody
MBS9522574-01 0.04 mL

RIMBP2 Antibody

Sign In for Pricing
View Details
RIMBP2 Antibody
MBS9522574-02 0.1 mL

RIMBP2 Antibody

Sign In for Pricing
View Details
RIMBP2 Antibody
MBS9522574-03 0.2 mL

RIMBP2 Antibody

Sign In for Pricing
View Details
RIMBP2 Antibody
MBS9522574-04 5x 0.2 mL

RIMBP2 Antibody

Sign In for Pricing
View Details
Antifungal agent 15
T40262 25 mg

Antifungal agent 15

Sign In for Pricing
View Details
Pde1b ORF Vector (Rat) (pORF)
ORF073257 1.0 µg DNA

Pde1b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details