MCL1 Peptide - middle region
MCL1 Peptide - middle region
Product Specifications
Product Name Alternative
TM, EAT, MCL1L, MCL1S, Mcl-1, BCL2L3, MCL1-ES, bcl2-L-3, mcl1/EAT
UniProt
Q07820
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001184249.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1413250-01 0.02 mg (E-Coli)
Recombinant Pseudomonas alginovora Alginate lyase (aly)
Sign In for Pricing
View Details MBS1413250-02 0.1 mg (E-Coli)
Recombinant Pseudomonas alginovora Alginate lyase (aly)
Sign In for Pricing
View Details MBS1413250-03 0.02 mg (Yeast)
Recombinant Pseudomonas alginovora Alginate lyase (aly)
Sign In for Pricing
View Details MBS1413250-04 0.1 mg (Yeast)
Recombinant Pseudomonas alginovora Alginate lyase (aly)
Sign In for Pricing
View Details MBS1413250-05 0.02 mg (Baculovirus)
Recombinant Pseudomonas alginovora Alginate lyase (aly)
Sign In for Pricing
View Details MBS1413250-06 0.02 mg (Mammalian-Cell)
Recombinant Pseudomonas alginovora Alginate lyase (aly)
Sign In for Pricing
View Details