Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCL1 Peptide - middle region

MCL1 Peptide - middle region

Product Specifications

Product Name Alternative

TM, EAT, MCL1L, MCL1S, Mcl-1, BCL2L3, MCL1-ES, bcl2-L-3, mcl1/EAT

UniProt

Q07820

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001184249.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P16-INK4a Recombinant Protein
orb1230971-01 0.005 mg

P16-INK4a Recombinant Protein

Sign In for Pricing
View Details
P16-INK4a Recombinant Protein
orb1230971-02 0.02 mg

P16-INK4a Recombinant Protein

Sign In for Pricing
View Details
Osteocalcin Rabbit Polyclonal Antibody (RBITC)
orb1055128 100 µL

Osteocalcin Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CBX7
MBS8528642-01 0.1 mL

Mouse Monoclonal Antibody to CBX7

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CBX7
MBS8528642-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to CBX7

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CBX7
MBS8528642-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to CBX7

Sign In for Pricing
View Details