Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYL2 Peptide - middle region

MYL2 Peptide - middle region

Product Specifications

Product Name Alternative

MLC2, CMH10

UniProt

P10916

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000423.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRD1/NRDC Rabbit Polyclonal Antibody (Fluoro594)
orb3103101 100 µg

NRD1/NRDC Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Hsfy2 3'UTR Lenti-reporter-Luc Vector
23970084 1.0 µg

Hsfy2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MIR3914-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV768553 1.0 µg DNA

MIR3914-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Amphiregulin (AREG) Antibody
abx131734-01 100 µL

Amphiregulin (AREG) Antibody

Sign In for Pricing
View Details
Amphiregulin (AREG) Antibody
abx131734-02 200 µL

Amphiregulin (AREG) Antibody

Sign In for Pricing
View Details
Amphiregulin (AREG) Antibody
abx131734-03 1 mL

Amphiregulin (AREG) Antibody

Sign In for Pricing
View Details