Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH6 Peptide - N-terminal region

CDH6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAD6, KCAD

UniProt

P55285

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004923.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRALELSGNSKNELNRSKRSWMWNQFFLLEEYTGSDYQYVGKLHSDQDRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GNAQ Antibody
RC-5353-01 50 μL

Recombinant GNAQ Antibody

Sign In for Pricing
View Details
Recombinant GNAQ Antibody
RC-5353-02 100 µL

Recombinant GNAQ Antibody

Sign In for Pricing
View Details
Recombinant GNAQ Antibody
RC-5353-03 1 mL

Recombinant GNAQ Antibody

Sign In for Pricing
View Details
GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G8]
TA502542BM 100 µL

GBA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G8]

Sign In for Pricing
View Details
Recombinant LTK Antibody
RC-5786-01 50 μL

Recombinant LTK Antibody

Sign In for Pricing
View Details
Recombinant LTK Antibody
RC-5786-02 100 µL

Recombinant LTK Antibody

Sign In for Pricing
View Details