Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSF Peptide - C-terminal region

CTSF Peptide - C-terminal region

Product Specifications

Product Name Alternative

CATSF, CLN13

UniProt

Q9UBX1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003784.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKRN2, NT (MKRN2, RNF62, Probable E3 ubiquitin-protein ligase makorin-2, RING finger protein 62) (MaxLight 490) discontinued
038458-ML490 100 µL

MKRN2, NT (MKRN2, RNF62, Probable E3 ubiquitin-protein ligase makorin-2, RING finger protein 62) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human Killer Cell Immunoglobulin-Like Receptor 2Dl1 (KIR2DL1) Protein
abx694096-01 20 µg

Human Killer Cell Immunoglobulin-Like Receptor 2Dl1 (KIR2DL1) Protein

Sign In for Pricing
View Details
Human Killer Cell Immunoglobulin-Like Receptor 2Dl1 (KIR2DL1) Protein
abx694096-02 100 µg

Human Killer Cell Immunoglobulin-Like Receptor 2Dl1 (KIR2DL1) Protein

Sign In for Pricing
View Details
1-Pyridin-2-ylcyclopropanecarbonitrile
MGA96028 2.5 g

1-Pyridin-2-ylcyclopropanecarbonitrile

Sign In for Pricing
View Details
Alexa Fluor® 700 anti-human CD29
GT07629 25 µg

Alexa Fluor® 700 anti-human CD29

Sign In for Pricing
View Details
Lentiviral mouse Foxd3 shRNA (UAS) - Lentiviral mouse Foxd3 shRNA (UAS) (100)
GTR15114678 1 Vial

Lentiviral mouse Foxd3 shRNA (UAS) - Lentiviral mouse Foxd3 shRNA (UAS) (100)

Sign In for Pricing
View Details