Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSF Peptide - C-terminal region

CTSF Peptide - C-terminal region

Product Specifications

Product Name Alternative

CATSF, CLN13

UniProt

Q9UBX1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003784.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itfg3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7137304 1.0 µg DNA

Itfg3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CYP27C1 Lentiviral Activation Particles (h2)
sc-409410-LAC-2 200 µL

CYP27C1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
MSK2 / RSK-B (RPS6KA4) (NM_003942) Human Recombinant Protein
TP312570M 100 µg

MSK2 / RSK-B (RPS6KA4) (NM_003942) Human Recombinant Protein

Sign In for Pricing
View Details
Mrpl19 Rat shRNA Plasmid (Locus ID 297372)
TR703088 1 Kit

Mrpl19 Rat shRNA Plasmid (Locus ID 297372)

Sign In for Pricing
View Details
NXPH4 AAV Vector (Human) (CMV)
32370101 1 µg

NXPH4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Atrial Natriuretic Factor (1-28) (hu, bo, po) ELISA Kit
S-1131 96 Well

Atrial Natriuretic Factor (1-28) (hu, bo, po) ELISA Kit

Sign In for Pricing
View Details