Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6R alpha, Human (Biotinylated, HEK293, Avi-His)

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha/CD126, Human consists of 468 amino acids (M1-R468) with two fibronectin type-III-like domains contained in the N-terminal part (113-217 a.a, 218-316 a.a), and a soluble form (1-365 a.a) . Soluble IL-6R (sIL-6R) binds IL-6 and dimerized gp130 to achieve trans signaling, and exhibits a tissue expression property in some immune systems. IL-6R alpha Protein, Human (L20-P365) is soluble and biotinylated recombinant protein expressed by HEK293 cells with a C-Terminal Avi-tag and a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-6R alpha Protein, Human (Biotinylated, HEK293, Avi-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6r-alpha-protein-human-biotinylated-hek293-avi-his.html

Smiles

LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

Molecular Formula

3570 (Gene_ID) P08887-1 (L20-P365) (Accession)

Molecular Weight

Approximately 65-85 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Garbers C, et al. Inhibition of classic signaling is a novel function of soluble glycoprotein 130 (sgp130), which is controlled by the ratio of interleukin 6 and soluble interleukin 6 receptor. J Biol Chem. 2011 Dec 16;286 (50) :42959-70.|[2]Malemud, et al. Defective JAK-STAT Pathway Signaling Contributes to Autoimmune Diseases. Curr Pharmacol Rep 4, 358-366.|[3]Larsen JV, et al. SorLA in Interleukin-6 Signaling and Turnover. Mol Cell Biol. 2017 May 16;37 (11) :e00641-16.|[4]Kang S, et al. Targeting Interleukin-6 Signaling in Clinic. Immunity. 2019 Apr 16;50 (4) :1007-1023.|[5]Giannitrapani L, et al. Circulating IL-6 and sIL-6R in patients with hepatocellular carcinoma. Ann N Y Acad Sci. 2002 Jun;963:46-52.|[6]Arnold P, et al. Joint Reconstituted Signaling of the IL-6 Receptor via Extracellular Vesicles. Cells. 2020 May 24;9 (5) :1307.|[7]Mishra AK, et al. Metformin inhibits IL-6 signaling by decreasing IL-6R expression on multiple myeloma cells. Leukemia. 2019 Nov;33 (11) :2695-2709.|[8]Gruber CN, et al. Mapping Systemic Inflammation and Antibody Responses in Multisystem Inflammatory Syndrome in Children (MIS-C) . Cell. 2020 Nov 12;183 (4) :982-995.e14.|[9]Misiak-Tłoczek A, et al. IL-6, but not IL-4, stimulates chemokinesis and TNF stimulates chemotaxis of tissue mast cells: involvement of both mitogen-activated protein kinases and phosphatidylinositol 3-kinase signalling pathways. APMIS. 2009 Aug;117 (8) :558-67.|[10]Oh JW, et al. Role of IL-6 and the soluble IL-6 receptor in inhibition of VCAM-1 gene expression. J Immunol. 1998 Nov 1;161 (9) :4992-9.|[11]Kim SK, et al. Melittin enhances apoptosis through suppression of IL-6/sIL-6R complex-induced NF-κB and STAT3 activation and Bcl-2 expression for human fibroblast-like synoviocytes in rheumatoid arthritis. Joint Bone Spine. 2011 Oct;78 (5) :471-7.|[12]Bharti R, Dey G, Das AK, Mandal M. Differential expression of IL-6/IL-6R and MAO-A regulates invasion/angiogenesis in breast cancer. Br J Cancer. 2018 May;118 (11) :1442-1452.|[13]Malte Peters, et al. Extramedullary Expansion of Hematopoietic Progenitor Cells in Interleukin (IL) -6–sIL-6R Double Transgenic Mice. J Exp Med (1997) 185 (4) : 755-766.|[14]Fattori E, et al. Development of progressive kidney damage and myeloma kidney in interleukin-6 transgenic mice. Blood. 1994 May 1;83 (9) :2570-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details