Ehd1 Peptide - middle region
Ehd1 Peptide - middle region
Product Specifications
Product Name Alternative
RGD1306960
UniProt
Q641Z6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EHD1 Rabbit Polyclonal Antibody (orb588775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001269373.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx704240-01 100 mL
Complete Medium for Mouse Bone Marrow-Derived Macrophage Cells
Sign In for Pricing
View Details abx704240-02 500 mL
Complete Medium for Mouse Bone Marrow-Derived Macrophage Cells
Sign In for Pricing
View Details 
245897-PE 100 µL
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (PE)
Sign In for Pricing
View Details 
orb3164217 100 µL
TFRC Recombinant Rabbit mAb, Pacific Blue conjugated
Sign In for Pricing
View Details