EEF1A1 Peptide - middle region
EEF1A1 Peptide - middle region
Product Specifications
Product Name Alternative
CCS3, EF1A, PTI1, CCS-3, EE1A1, EEF-1, EEF1A, EF-Tu, LENG7, eEF1A-1, GRAF-1EF, HNGC:16303
UniProt
P68104
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EEF1A1 Rabbit Polyclonal Antibody (orb55756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001393.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
9-33034 Set
Mouse Endothelium PrimaCell™: Normal Vascular Endothelial Cells Growth Supplements with Serum (for 500 mL medium)
Sign In for Pricing
View Details 