Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1A1 Peptide - middle region

EEF1A1 Peptide - middle region

Product Specifications

Product Name Alternative

CCS3, EF1A, PTI1, CCS-3, EE1A1, EEF-1, EEF1A, EF-Tu, LENG7, eEF1A-1, GRAF-1EF, HNGC:16303

UniProt

P68104

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEF1A1 Rabbit Polyclonal Antibody (orb55756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001393.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP9 Antibody (Center)
orb1928716-01 50 µL

CASP9 Antibody (Center)

Sign In for Pricing
View Details
CASP9 Antibody (Center)
orb1928716-02 100 µL

CASP9 Antibody (Center)

Sign In for Pricing
View Details
MDM2 Antibody
orb1318604-01 30 µL

MDM2 Antibody

Sign In for Pricing
View Details
MDM2 Antibody
orb1318604-02 50 μL

MDM2 Antibody

Sign In for Pricing
View Details
MDM2 Antibody
orb1318604-03 100 µL

MDM2 Antibody

Sign In for Pricing
View Details
KGP1 Polyclonal Antibody
MBS8531233-01 0.1 mg

KGP1 Polyclonal Antibody

Sign In for Pricing
View Details