Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTRF1L Peptide - N-terminal region

MTRF1L Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRF1L, HMRF1L, mtRF1a

UniProt

Q9UGC7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTRF1L Rabbit Polyclonal Antibody (orb55699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107656

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX3 (DDX3X) Human Gene Knockout Kit (CRISPR)
KN204171BN 1 Kit

DDX3 (DDX3X) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benz[j]aceanthrylen-2(1H)-one13C2,d2 and Benz[e]aceanthrylen-6(5H)-one13C2,d2
TRC-B183543-1MG 1 mg

Benz[j]aceanthrylen-2(1H)-one13C2,d2 and Benz[e]aceanthrylen-6(5H)-one13C2,d2

Sign In for Pricing
View Details
Recombinant Human NMP22 Protein (His tag)
PDEH100116-01 20 µg

Recombinant Human NMP22 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NMP22 Protein (His tag)
PDEH100116-02 100 µg

Recombinant Human NMP22 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NMP22 Protein (His tag)
PDEH100116-03 500 µg

Recombinant Human NMP22 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human NMP22 Protein (His tag)
PDEH100116-04 1 mg

Recombinant Human NMP22 Protein (His tag)

Sign In for Pricing
View Details